Share this post on:

Name:
FLT-3L Protein

Synonyms:
FL; FLG3L; Flt3 ligand; Flt-3 Ligand; Flt3L; FLT3LG; fms-related tyrosine kinase 3 ligand; SL cytokine

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P49772

Gene Id:
Gly27-Arg188GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRGGGSHHHHHHHH

Molecular Weight:
20-33kDa(Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
FLT-3 ligand promotes long- term expansion anddifferentiation of human pro-B-cells in the presence of IL-7 or in combinationof IL-7 and IL-3.The human FLT-3 ligand also stimulates the proliferation ofcells expressing murine FLT-3 receptors. In combination with SCF and IL-3,FLT-3 ligand can cause expansion of cells with the marker spectrum CD34(+)CD38(-). Alone, FLT-3 ligand supports the survival of precursors in the lineageof blood-forming cells such as CFU-GM, CFU- GEMM, and the very primitive highproliferative potential colony-forming cells, HPP- CFC. flt-3 ligand only hasmarginal effects on progenitors for erythroid cells and megakaryocytes.

Reference:
1.Cancer Res. 2009 Oct 1,69(19):7747-55.2.Blood, Jul 2009, 114: 835 – 843. 3. J. Immunol., Jun 2009, 182: 7408 – 7414.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Angiopoietin-1 Protein
PGLYRP2/PGRP-L Protein
Popular categories:
CD29/Integrin beta-1
Fluorescent-labeled Recombinant Proteins

Share this post on:

Author: Adenosylmethionine- apoptosisinducer