Share this post on:

Name:
Adrenomedullin/ADM Protein

Synonyms:
AM Protein, Human; PAMP Protein, Human

Species Name:
Human

Label Name:
Human Fc Tag

Marker Name:
Unconjugated

Accession:
P35318

Gene Id:
Tyr95-Tyr146PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRMDYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Molecular Weight:
30-38kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Adrenomedullin (ADM) is a 52-amino acid peptide homologous to calcitonin gene-related peptide (CGRP), a member of the Adrenomedullin family originally isolated from human pheochromocytoma. It plays a key role in the regulation of many physiological processes, especially those of the cardiovascular and lymphatic systems. It also can be detected in lung, ventricle and kidney tissues. ADM is expressed in a variety of tissues in the human body and is fundamentally involved in multitude biological processes. It is believed that Adrenomedullin functions through combinations of the calcitonin receptor like receptor and receptor activity-modifying proteins complexes, as well as CGRP receptors.

Reference:
1.Review Pol J Pharmacol . 2004 Jan-Feb;56(1):5-27.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NCAM-1/CD56 Protein
Chemerin/RARRES2 Protein
Popular categories:
IgG4
CT Receptor (Calcitonin Receptor)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer