Share this post on:

Name:
TECK/CCL25 Protein

Synonyms:
Thymus Expressed Chemokine, CCL25

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
O15444-1

Gene Id:
Gln24-Leu150MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Molecular Weight:
16kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
A novel CC chemokine was identified in the thymus of mouse and human and was designated TECK (thymus-expressed chemokine). TECK has weak homology to other CC chemokines and maps to mouse chromosome 8. Besides the thymus, mRNA encoding TECK was detected at substantial levels in the small intestine and at low levels in the liver. TECK has been reported to chemoattract dendritic cells, thymocytes, and activated macrophages. TECK is a specific agonist for a human orphan receptor called GPR-9-6. Human TECK also induced the in vitro migration of HEK 293/human GPR-9-6 cells. These results confirm that GPR-9-6 is a specific receptor for TECK. Recombinant human TECK is a protein containing 127 amino acid residues, including the four conserved cysteine residues present in CC chemokines.

Reference:
1.\tImmunity. 1997 Aug;7(2):291-301. doi: 10.1016/s1074-7613(00)80531-2. 2.\tJ Immunol. 1999 May 15;162(10):5671-5.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TREM-2 Protein
LAMP3/CD208 Protein
Popular categories:
ENPP-1
Tyrosine-protein Kinase Lyn

Share this post on:

Author: Adenosylmethionine- apoptosisinducer