Share this post on:

Name:
IL-3 Protein

Synonyms:
il-3

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P08700

Gene Id:
Ala20-Phe152APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Weight:
18-27 kDa(Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
IL-3 (also known as multispecific hemopoietin) is naturally produced by both Th1 and Th2 lymphocytes, mast cells, and eosinophils. IL-3 stimulates the production of macrophages, granulocytes, and dendritic cells from bone marrow precursors. The IL-3 is involved in bone marrow hemopoiesis and dendritic cell maturation in anti-viral or antitumor reactivity. IL-3 binds with high affinity to the IL-3 receptor α (IL-3Rα/CD123) and then associates with the βc subunit. IL-3 is the most important growth and activating factor for human and mouse basophils, primary effector cells of allergic disorders. IL-3-activated basophils and mast cells are also involved in different chronic inflammatory disorders, infections, and several types of cancer. IL-3 induces the release of cytokines (i.e., IL-4, IL-13, CXCL8) from human basophils and preincubation of basophils with IL-3 potentiates the release of proinflammatory mediators and cytokines from IgE and C5a-activated basophils. IL-3 synergistically potentiates IL-33-induced mediator release from human basophils. IL-3 plays a pathogenic role in several hematologic cancers and may contribute to autoimmune and cardiac disorders.IL-3Rα/CD123 is also highly expressed on human plasmacytoid DCs, making IL-3 a crucial survival factor for the rare blastic plasmacytoid DC neoplasm (BPDCN). IL-3 supports the proliferation of mouse and human B cells. IL-3 and GM-CSF stimulate the adhesion of human monocytes to endothelial cells. Human endothelial cells are an important target of IL-3. IL-3 activates IL-3 receptor and the proliferation of human endothelial cells and promotes in vivo vessel formation. The proangiogenic activity of IL-3 could contribute to its role in cancer initiation and progression. IL-3 is a growth factor for microglia and modulates mouse and human neurons. Finally, IL-3 regulates bone homeostasis through the modulation of osteoblast differentiation.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OX40/TNFRSF4 Protein
AKR1C3 Protein
Popular categories:
CXCL12/SDF-1 beta
Growth Differentiation Factor-8 (GDF-8)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer