Name:
IL-3 Protein
Synonyms:
il-3
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P08700
Gene Id:
Ala20-Phe152APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Molecular Weight:
18-27 kDa(Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
IL-3 (also known as multispecific hemopoietin) is naturally produced by both Th1 and Th2 lymphocytes, mast cells, and eosinophils. IL-3 stimulates the production of macrophages, granulocytes, and dendritic cells from bone marrow precursors. The IL-3 is involved in bone marrow hemopoiesis and dendritic cell maturation in anti-viral or antitumor reactivity. IL-3 binds with high affinity to the IL-3 receptor α (IL-3Rα/CD123) and then associates with the βc subunit. IL-3 is the most important growth and activating factor for human and mouse basophils, primary effector cells of allergic disorders. IL-3-activated basophils and mast cells are also involved in different chronic inflammatory disorders, infections, and several types of cancer. IL-3 induces the release of cytokines (i.e., IL-4, IL-13, CXCL8) from human basophils and preincubation of basophils with IL-3 potentiates the release of proinflammatory mediators and cytokines from IgE and C5a-activated basophils. IL-3 synergistically potentiates IL-33-induced mediator release from human basophils. IL-3 plays a pathogenic role in several hematologic cancers and may contribute to autoimmune and cardiac disorders.IL-3Rα/CD123 is also highly expressed on human plasmacytoid DCs, making IL-3 a crucial survival factor for the rare blastic plasmacytoid DC neoplasm (BPDCN). IL-3 supports the proliferation of mouse and human B cells. IL-3 and GM-CSF stimulate the adhesion of human monocytes to endothelial cells. Human endothelial cells are an important target of IL-3. IL-3 activates IL-3 receptor and the proliferation of human endothelial cells and promotes in vivo vessel formation. The proangiogenic activity of IL-3 could contribute to its role in cancer initiation and progression. IL-3 is a growth factor for microglia and modulates mouse and human neurons. Finally, IL-3 regulates bone homeostasis through the modulation of osteoblast differentiation.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OX40/TNFRSF4 Protein
AKR1C3 Protein
Popular categories:
CXCL12/SDF-1 beta
Growth Differentiation Factor-8 (GDF-8)