Share this post on:

Name:
CNTF Protein

Synonyms:
CNTF

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P26441-1

Gene Id:
Ala2-Met200, with N-terminal 6*His MHHHHHHDDDDKAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Molecular Weight:
26-28 kDa(Reducing)

Purity:
>97% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:

Quality Statement:
Ciliary neurotrophic factor (CNTF) is a member of the interleukin-6 family of cytokines. CNTF is a differentiating cytokine that drives cells toward a predominantly astrocytic fate. In HD, CNTF is the most widely studied neurotrophic factor. CNTF is the first and currently the only trophic factor to enter clinical trails in HD. CNTF has trophic effects on striatal neurons as seen in both in vitro and in vivo studies. Some of the earliest studies administered CNTF to the brain by direct infusion of the protein using pumps. An infusion cannula was implanted directly into the striatum and recombinant CNTF was continuously infused using an osmotic pump. This method of CNTF administration was efficient at significantly reducing cell death within the QA-lesioned striatum. A major pitfall of this method of administration is the need to constantly infuse CNTF into striatum. Additionally, large amounts of CNTF may be needed at one time to establish adequate diffusion throughout the striatum.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
USP7 Protein
Animal-Free IL-5 Protein
Popular categories:
Integrin alpha V beta 3
Receptor Serine/Threonine Kinases

Share this post on:

Author: Adenosylmethionine- apoptosisinducer