Share this post on:

Name:
TNF-α Protein

Synonyms:
TNF-alpha, Tumor Necrosis Factor, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFA, TNFSF2

Species Name:
Rhesus macaque

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P48094

Gene Id:
Val77-Leu233 VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL

Molecular Weight:
17.3kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, 2mM TCEP, pH 7.4

Quality Statement:
Tumour Necrosis Factor α (TNFα), is an inflammatory cytokine produced by macrophages/monocytes during acute inflammation and is responsible for a diverse range of signalling events within cells, leading to necrosis or apoptosis. The protein is also important for resistance to infection and cancers. In view of these facts, TNF-α has been recommended as an important target for discovering drugs for autoimmune and inflammatory diseases and cancer.

Reference:
1.\tMicrosc Res Tech. 2000 Aug 1;50(3):184-95.2.\tMethods Mol Biol. 2021;2248:271-279. doi: 10.1007/978-1-0716-1130-2_21.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HMBS/Porphobilinogen deaminase Protein
Animal-Free MIF Protein
Popular categories:
Caspase-4
CD321/JAM-A

Share this post on:

Author: Adenosylmethionine- apoptosisinducer