Name:
TNF-α Protein
Synonyms:
Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2 (TNF-a)
Species Name:
Rabbit
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P04924
Gene Id:
Val78-Leu235VTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
Molecular Weight:
17.5kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Tumor Necrosis Factor alpha (TNF-α), is an inflammatorycytokine produced by macrophages/monocytes during acute inflammation and isresponsible for a diverse range of signaling events within cells, leading tonecrosis or apoptosis. TNF-α exerts many of its effects by binding to either a55 kDa cell membrane receptor termed. TNF-α activates signals through tworeceptors, TNF-R1, which is expressed on most cell types, and TNF-R2, which isexpressed mainly on immune cells. TNF-α can have many functions including, tostimulate of phagocytosis in macrophages, to chemoattract neutrophils, toincrease insulin resistance and to induce fever.
Reference:
1.D Pennica, et al. (1984) Human tumournecrosis factor: precursor structure, expression and homology to lymphotoxin.Nature.312(5996):724-9. DOI: 10.1038/312724a0.2. S A Nedospasov, et al. (1986) Tandem arrangement of genes coding fortumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the humangenome. Cold Spring Harb Symp Quant Biol.51(1) 1:611-24. DOI:10.1101/sqb.1986.051.01.073.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cofilin-1 Protein
Der p 23 Protein
Popular categories:
Integrin alpha 8 beta 1
Adhesion GPCRs
