IL-3 Rα/CD123 Protein | Adenosylmethionine

Name:
IL-3 Rα/CD123 Protein

Synonyms:
IL3R, IL3RA, IL-3Ra, IL-3R-alpha, IL3RAY, IL3RX, IL3RY, CD123 antigen, hIL3Ra, hIL-3Ra, MGC34174, IL-3 R alpha

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
G8F3K3-1

Gene Id:
Arg18-Arg302, with C-terminal 8*His RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSRGGGSHHHHHHHH

Molecular Weight:
50-65kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Human IL-3 Rα is expressed from human 293 cells. It contains AA Thr19 – Arg305. This protein carries a polyhistidine tag at the C-terminus. Interleukin 3 receptor alpha (low affinity) (IL3RA), also known as CD123 (Cluster of Differentiation 123) is a 45-62kDa glycoprotein member of the hematopoietin receptor superfamily. This protein associates with a beta subunit common to the receptors for IL-5 and granulocyte-macrophage colony-stimulating factor (GM-CSF) to form a high-affinity receptor for IL-3. The interleukin-3 receptor α chain (CD123) has been identified as a potential immunotherapeutic target because it is overexpressed in AML compared with normal hematopoietic stem cells.

Reference:
1.\tLIU, KEQIANG, ZHU, MENGRU, HUANG, YAO, et al. CD123 and its potential clinical application in leukemias [J]. Life sciences,2015,122(1):59-64.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OSM Protein
Fructose-bisphosphate aldolase A/ALDOA Protein
Popular categories:
Platelet Factor 4
IFN-alpha 5

Author: Adenosylmethionine- apoptosisinducer

Related Posts