Share this post on:

Name:
FGF-17 Protein

Synonyms:
fgf17b

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
O60258

Gene Id:
Thr23-Thr216TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Weight:
25kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 600mM NaCl, pH8.0

Quality Statement:
Fibroblast Growth Factors (FGFs) are polypeptides with diverse activities in development and physiology. The mammalian Fgf family can be divided into the intracellular Fgf11/12/13/14 subfamily (iFGFs), the hormone-like Fgf15/21/23 subfamily (hFGFs), and the canonical FGF subfamilies, including Fgf1/2/5, Fgf3/4/6, Fgf7/10/22, Fgf8/17/18, and Fgf9/16/20. Recent evidence suggests that Fgf17 is important in neural patterning. During embryonic development, Fgf17 is expressed in the patterning centers for the rostral forebrain and the midbrain/hindbrain. Studies of Fgf17-deficient mice showed that Fgf17 is required for development of the cerebellar vermis and inferior colliculus and for the regionalization of frontal cortex. Fgf17 ablation reduced the size of the dorsal frontal cortex and the extent of frontal cortex projections to subcortical targets.

Reference:
1.\tK Scearce-Levie, E D Roberson, H Gerstein. Abnormal social behaviors in mice lacking Fgf17. Genes Brain Behav. 2008 Apr;7(3):344-54. doi: 10.1111/j. 2.\tNobuyuki Itoh 1, David M Ornitz. Functional evolutionary history of the mouse Fgf gene family. Dev Dyn. 2008 Jan;237(1):18-27. doi: 10.1002/dvdy.21388.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CXCL3/CINC-2 alpha Protein
EGFR Protein
Popular categories:
Chemokine Receptor
CD28

Share this post on:

Author: Adenosylmethionine- apoptosisinducer