CD47 Protein | Adenosylmethionine

Name:
CD47 Protein

Synonyms:
CD47 ;antigen identified by monoclonal 1D8, Antigenic surface determinant protein OA3, CD47 antigen (Rh-related antigen, integrin-associated signal transducer), CD47 antigen, CD47 glycoprotein, CD47 molecule, CD47, IAP, IAPintegrin associated protein, Integrin-associated protein, leukocyte surface antigen CD47, MER6, MER6integrin-associated signal transducer, OA3, Protein MER6, Rh-related antigen

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q08722

Gene Id:
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH

Molecular Weight:
33-45 kDa(Reducing)

Purity:
＞95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.2EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS pH7.2, 5% trehalose

Quality Statement:
CD47 (Cluster of Differentiation 47), also known as integrin associated protein (IAP), is a transmembrane protein that in humans is encoded by the CD47 gene. It belongs to the immunoglobulin superfamily and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPα). CD47 is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. Furthermore, it plays a key role in immune and angiogenic responses. Also CD47 is ubiquitously expressed in human cells and has found to be overexpressed in many different tumor cells.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Lck Protein
Animal-Free IL-6 Protein
Popular categories:
TrkA
RIO Kinase 1

Author: Adenosylmethionine- apoptosisinducer

Related Posts