Share this post on:

Name:
IL-1β Protein

Synonyms:

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P01584

Gene Id:
Ala117-Ser269APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Weight:
21-23 kDa(Reducing)

Purity:
>95% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:

Quality Statement:
Interleukin-1β (IL-1β) is a major cytokine involved in monocyte activation and activation of proinflammatory signaling pathways in peripheral tissues and brain. IL-1β expression and its secretion are tightly regulated. IL-1β is released by several cell types, including activated macrophages, monocytes, and cells within the hypothalamus, where it can stimulate its own expression.IL-1β is present and active in the luteinized ovary as shown by its expression in human granulosa lutein cells and in follicular fluid macrophages that are natural components of the corpus luteum tissue. IL-1β, its corresponding receptor antagonist Interleukin Receptor Antagonist-1 (IL-1RA), and Interleukin 1 alpha (IL-1α) are encoded by the genes IL-1B, IL-1RN, and IL-1A respectively, as constituents of the Interleukin 1 (IL-1) gene cluster. IL-1β is a crucial candidate due to its dual role as both a proinflammatory signaling molecule and an inhibitor of gastric acid secretion. IL-1β can promote tumor growth, but also antitumor activities. The presence of IL-1β and other inflammatory cytokines also has been noted at an early phase of plaque formation in the brains of patients with Alzheimer’s disease.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cochlin/COCH Protein
NRAS Protein
Popular categories:
ILT-7/CD85g
Ubiquitin-Specific Peptidase 40

Share this post on:

Author: Adenosylmethionine- apoptosisinducer