Share this post on:

Name:
Complement C5a Protein

Synonyms:
Complement Component C5a

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P06684

Gene Id:
Asn679 – Arg755NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR

Molecular Weight:
10kDa (Reducing)

Purity:
>95% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.5-1mg/ml according to the size in ultrapure water after rapid centrifugation.r rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 300mM NaCl, pH8.0

Quality Statement:
Complement Component C5a (C5a) is also known as C5, and is a protein fragment released from complement component C5. C5a is an extremely potent proinflammatory mediator, as well as a potent chemotactic factor for neutrophils and other leukocytes. It causes histamine release, increases in vascular permeability, induces several cytokines production from leukocytes, enhances neutrophil-endothelial cell adhesion, and augments the humoral and cell-mediated immune response. C5a is also chemotactic for dendritic cells (DCs), germinal center B cells, and T cells. Thus, anaphalatoxins participate in the recruitment of various leukocytes into sites of inflammation during infection and tissue injury.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD200R4 Protein
NAP-2/CXCL7 Protein
Popular categories:
DSG3
Langerin/CD207

Share this post on:

Author: Adenosylmethionine- apoptosisinducer