Share this post on:

Name:
IgG1 Fc Protein

Synonyms:

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P01857-1

Gene Id:
EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH

Molecular Weight:
30-33 kDa(还原状态)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:

Quality Statement:
Fc is a crystallizable fragment composed of the carboxyl terminal of two kinds of immunoglobulin heavy chain, which is connected to each other by disulfide bond. The Fc fragment contains the carboxyl terminal part of the heavy chain fixation region, which is responsible for the effect function of immunoglobulin (complement fixation, binding to the cell membrane through Fc receptors, and placental transport). It is reported that IgG1 Fc, as a potential anti-inflammatory drug, plays a new role in the treatment of human autoimmune diseases.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Nucleobindin-2 Protein
ACBD7 Protein
Popular categories:
Caspase 12
GFR alpha-2

Share this post on:

Author: Adenosylmethionine- apoptosisinducer