Name:
FLT-3L Protein
Synonyms:
Fms-like tyrosine kinase 3, flt-3
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P49771
Gene Id:
Thr27-Pro185TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP
Molecular Weight:
17-28 kDa(Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
Quality Statement:
Fms-like tyrosine kinase 3 (FLT-3) is a cytokine receptor expressed on the surface of bone-marrow progenitor of hematopoietic cells. FLT-3 ligands (FLT-3L) are produced by peripheral blood mononuclear cells, and found in various human body fluids. FLT-3L is a cytokine that promotes the survival, proliferation, and differentiation of hematopoietic progenitors in synergy with other growth factors, such as stem cell factor. FLT-3 signal is involved in the regulation of vessel formation as well as B cell differentiation, suggesting that FLT-3 signal contributes to the pathogenesis of vascular abnormalities and immune dysregulation in rheumatic diseases. The FLT-3L plays a role in complex cytokine interactions in the process of proliferation and differentiation of various hematologic periods while it is a router in early cell interactions. The FLT-3 receptor is a transmembrane protein that reaches its biologically active form by proteolytic lysis. It was suggested that with its proliferative activity, the FLT-3L also has an antitumor effect. The FLT-3L is an earlier releaser of the progenitor cells from the stem cell pool according to GM-CSF and G-CSF actions, which occur later. Additionally, a study on mouse models showed that the FLT-3L increases the blood amount of CD34 cells. These features gave rise to the idea that recombinant FLT-3L could be used in bone marrow transplantation to evoke cell mobilization. Similarly, some authors theorized that the FLT-3L could be used in many pathological diseases such as Fanconi and aplastic anemia that originated from stem cell defects.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free LIF Protein
RANK L/TNFSF11 Protein
Popular categories:
Integrin alpha 1 beta 1
CD1c