Share this post on:

Name:
FLT-3L Protein

Synonyms:
Fms-like tyrosine kinase 3, flt-3

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P49771

Gene Id:
Thr27-Pro185TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

Molecular Weight:
17-28 kDa(Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:

Quality Statement:
Fms-like tyrosine kinase 3 (FLT-3) is a cytokine receptor expressed on the surface of bone-marrow progenitor of hematopoietic cells. FLT-3 ligands (FLT-3L) are produced by peripheral blood mononuclear cells, and found in various human body fluids. FLT-3L is a cytokine that promotes the survival, proliferation, and differentiation of hematopoietic progenitors in synergy with other growth factors, such as stem cell factor. FLT-3 signal is involved in the regulation of vessel formation as well as B cell differentiation, suggesting that FLT-3 signal contributes to the pathogenesis of vascular abnormalities and immune dysregulation in rheumatic diseases. The FLT-3L plays a role in complex cytokine interactions in the process of proliferation and differentiation of various hematologic periods while it is a router in early cell interactions. The FLT-3 receptor is a transmembrane protein that reaches its biologically active form by proteolytic lysis. It was suggested that with its proliferative activity, the FLT-3L also has an antitumor effect. The FLT-3L is an earlier releaser of the progenitor cells from the stem cell pool according to GM-CSF and G-CSF actions, which occur later. Additionally, a study on mouse models showed that the FLT-3L increases the blood amount of CD34 cells. These features gave rise to the idea that recombinant FLT-3L could be used in bone marrow transplantation to evoke cell mobilization. Similarly, some authors theorized that the FLT-3L could be used in many pathological diseases such as Fanconi and aplastic anemia that originated from stem cell defects.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free LIF Protein
RANK L/TNFSF11 Protein
Popular categories:
Integrin alpha 1 beta 1
CD1c

Share this post on:

Author: Adenosylmethionine- apoptosisinducer