Share this post on:

Name:
IL-22 Protein

Synonyms:
IL22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18, interleukin 22

Species Name:
Rat

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q198B4

Gene Id:
Leu27-Val172 MLPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLRNACV

Molecular Weight:
16kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Interleukin-22(IL-22) is a member of the IL10 family of cytokines that mediate cellular inflammatory responses and functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. IL-22 has a role in the remodeling of the uterine tissue in the inflammatory environment by regulating epithelial-mesenchymal transition markers called E- and N-cadherin. Therefore, IL-22 contributes to the proper regeneration of endometrial layers after inflammation-triggered abortion. Thus, it might have a practical significance to be utilized as a treatment option postpartum (enhanced regeneration function) and in secondary infertility caused by inflammation (enhanced barrier/protector function). IL-22 is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2).

Reference:
1.Ganieva U. et al. (2022) IL-22 regulates endometrial regeneration by enhancing tight junctions and orchestrating extracellular matrix. Front Immunol. 13:955576. 2.Pavlidis P. et al. (2022) Interleukin-22 regulates neutrophil recruitment in ulcerative colitis and is associated with resistance to ustekinumab therapy. Nat Commun. 13(1): 5820.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
DR3/TNFRSF25 Protein
CD229/SLAMF3 Protein
Popular categories:
L-Selectin/CD62L
Ubiquitin-Specific Peptidase 38

Share this post on:

Author: Adenosylmethionine- apoptosisinducer