Share this post on:

Name:
Fc γ RIIB/CD32b Protein

Synonyms:
Fc γ RIIb, CD32b;Fc gamma Receptor IIB/C, CD32, CD32b,CDw32

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P31994-1

Gene Id:
APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP HHHHHHHHHH

Molecular Weight:
27 -30 kDa(还原状态)

Purity:
>98%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs is identified as three types: RI (CD64), RII (CD32) and RIII (CD16). Human Fc γ RII / CD32 has three genes, CD32A, B and C, respectively. CD32 is a low affinity Fc receptor. Low-affinity immunoglobulin Fc γ region receptor II-b, namely CD32b, also known as FCGR2B, FCG2, IGFR2. CD32b was expressed on B cells and myeloid dendritic cells. The co-junction of CD32b on dendritic cells inhibits maturation and prevents cell activation. CD32b may also be a target for monoclonal antibody therapy of malignant tumors.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CXCL3/CINC-2 alpha Protein
CTHRC1 Protein
Popular categories:
CD85c/LIR-8
Neuropoietin

Share this post on:

Author: Adenosylmethionine- apoptosisinducer