Share this post on:

Name:
M-CSF Protein

Synonyms:
M-CSF; CSF-1; Macrophage Colony Stimulating Factor;

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P07141-1

Gene Id:
Lys33-Pro187MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Molecular Weight:
18.2 kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12months from date of receipt, -20 to -70 °C as supplied. · 6months, -20 to -70 °C under sterile conditions after reconstitution.· 1week, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris,200mM NaCl,pH8.0

Quality Statement:
Macrophage-Colony Stimulating Factor (M-CSF),also known as Colony Stimulating Factor-1 (CSF-1), is a hematopoietic growthfactor. It can stimulate the survival, proliferation and differentiation ofmononuclear phagocytes, in addition to the spreading and motility ofmacrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts,and endothelial cells. M-CSF interaction with its receptor, c-fms, has beenimplicated in the growth, invasion, and metastasis of several diseases,including breast and endometrial cancers.

Reference:
1. Cosman D, Wignall J, Anderson D, etal. 1988. Behring Inst Mitt: 15-26.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Glypican-3/GPC3 Protein
METAP2/Methionine aminopeptidase 2 Protein
Popular categories:
Ubiquitin-Conjugating Enzyme E2 D1
Endothelial Cell-Selective Adhesion Molecule (ESAM)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer