Share this post on:

Name:
IL-15 Protein

Synonyms:

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P40933

Gene Id:
Asn49-Ser162NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Molecular Weight:
12 kDa(Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:

Quality Statement:
Interleukin-15 (IL-15), a cytokine discovered in 1994, supports the homeostasis of cytotoxic immune cells, exhibits a broad biological activity. IL-15 stimulate the proliferation of activated T cells as well as to facilitate the induction of cytotoxic T-lymphocytes (like CD8+), and the generation, proliferation, and activation of NK cells. Therefore, IL-15 is applied to the rapidly expanding cancer immunotherapy field combining with other agents, i.e., checkpoint inhibitors, monoclonal antibodies, chemotherapy, radiation, and chimeric antigen receptor T (CAR-T) cells, in order to target multiple mechanisms and enhance the immune response against tumors, which provides advantages to control and treat cancers.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ECM1 Protein
Nucleobindin-2 Protein
Popular categories:
BST1/CD157
Frizzled

Share this post on:

Author: Adenosylmethionine- apoptosisinducer