Share this post on:

Name:
VNN1/Vanin-1 Protein

Synonyms:
Pantetheinase, Tiff66, Vascular Non-Inflammatory Molecule 1

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q9Z0K8

Gene Id:
Leu24-Ser487, with C-terminal 8*His LDTFLAAVYEHAVILPKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSGIYAPDSPRVFHYDRKTQEGKLLFAQLKSHPIHSPVNWTSYASSVESTPTKTQEFQSIVFFDEFTFVELKGIKGNYTVCQNDLCCHLSYQMSEKRADEVYAFGAFDGLHTVEGQYYLQICILLKCKTTNLRTCGSSVDTAFTRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVSSDGRLVSLKPTSGPVLTIGLFGRLYGKDWASGGGSHHHHHHHH

Molecular Weight:
60-72kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Vanin 1, or pantetheinase, is a glycosylphosphatidylinositol(GPI)-anchored ectoenzyme that has been shown to be widely expressed in many tissues, including the liver, kidney and gut. Pantetheinase catalyzes the hydrolysis of pantetheine to pantothenic acid (vitamin B5) and cysteamine, which together with cystamine participate in the regulation of cellular pathways involved in oxidative stress and inflammation. Germline deletion of vanin 1 in mice results in an absence of tissue cysteamine. As such, vanin 1 has been shown to both protect tissues from and sensitize tissues to damage in different disease settings. Mice that lack vanin 1 display resistance to oxidative tissue damage induced by whole-body γ-irradiation, with a reduction in apoptosis and inflammation. The absence of cellular cysteamine was associated with elevated levels of the potent antioxidant glutathione.

Reference:
1.\tYkelien L Boersma. The structure of vanin 1: a key enzyme linking metabolic disease and inflammation. Acta Crystallogr D Biol Crystallogr. 2014 Dec 1;70(Pt 12):3320-9. doi: 10.1107/S1399004714022767. Epub 2014 Nov 28.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PLA2G16 Protein
Dxr/DXP reductoisomerase Protein
Popular categories:
CD151
Serpin E3

Share this post on:

Author: Adenosylmethionine- apoptosisinducer