Name:
Siglec-6/CD327 Protein
Synonyms:
Species Name:
Human
Label Name:
Human Fc Tag
Marker Name:
Unconjugated
Accession:
AAH35359.2
Gene Id:
QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight:
75-95 kDa(Reducing)
Purity:
＞95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Quality Statement:
Siglec-6 also called CD327, one of the Sialic acid-binding immunoglobulin-like lectins (Siglecs) and type-1 transmembrane protein. Siglec-6 is predominantly expressed by mast cells, B cells, and a minor AS-type dendritic cell subset. Siglec-6 is an immune-inhibitory CD33-related Siglec and strongly binds to sialylated Tn-structures. As an exception, all Siglecs recognize the carboxyl group of sialic acid, but only Siglec-6 does not require the glycerol side-chain for binding. In cancer, Siglec-6 was recently found to be upregulated in circulating and urinary CD8+ T-cell of non–muscle-invasive bladder cancer patients, wherein a high level of Siglec-6 was associated with advanced bladder cancer. Additionally, Siglec-6 is prevalently expressed on acute myeloid leukemia blasts and transformed B cells in chronic lymphocytic leukemia. As Siglec-6 mRNA and protein are not expressed in hematopoietic stem cells, they are novel targets for CAR-T cell immunotherapy in chronic lymphocytic leukemia.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PDE3A Protein
Animal-Free IL-17A Protein
Popular categories:
TSH Receptor
Mineralocorticoid Receptor
