Share this post on:

Name:
MIP-3α/CCL20 Protein

Synonyms:
CCL-20, CKb4, Exodus, LARC, MIP-3-alpha, MIP-3a, MIP3A, SCYA20, ST38, chemokine (C-C motif) ligand 20, C-C motif chemokine ligand 20

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P78556

Gene Id:
Ala27-Met96MASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Molecular Weight:
8kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is the only chemokine ligand for C-C motif chemokine ligand-receptor 6(CCR6), and is a member of the CC family and the alpha subfamily chemokines. Structurally, CCL20 contains four exons and three introns at their junctions which differ from other members of the CC chemokines. Chemokines are well known to play essential roles in the recruitment of immune cells and the development of lymphoid tissues. They also regulate the recruitment and trafficking of leucocytes during homeostasis and inflammation. Inflammatory chemokines are released to induce leukocyte infiltration to inflammatory site. Beyond these physiological roles, emerging studies have highlighted the indispensable role of chemokines and their receptors in tumor progression. It has become evident that chemokines regulate several oncogenic processes, including host immune response, tumor growth, angiogenesis, metastasis and chemoresistance.

Reference:
1.\tKwantwi LB, Wang S, Sheng Y, Wu Q. Multifaceted roles of CCL20 (C-C motif chemokine ligand 20): mechanisms and communication networks in breast cancer progression. Bioengineered. 2021 Dec;12(1):6923-6934. doi: 10.1080/21655979.2021.1974765. PMID: 34569432; PMCID: PMC8806797.2.\tIkawa T, Miyagawa T, Fukui Y, Minatsuki S, Maki H, Inaba T, Hatano M, Toyama S, Omatsu J, Awaji K, Norimatsu Y, Watanabe Y, Yoshizaki A, Sato S, Asano Y. Association of serum CCL20 levels with pulmonary vascular involvement and primary biliary cholangitis in patients with systemic sclerosis. Int J Rheum Dis. 2021 May;24(5):711-718. doi: 10.1111/1756-185X.14103. Epub 2021 Mar 22. PMID: 33750014.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Caspase-14/CASP14 Protein
ABP1/AOC1 Protein
Popular categories:
Adrenomedullin
Carbonic Anhydrase 14 (CA-XIV)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer