Share this post on:

Name:
Shh Protein

Synonyms:
Sonic Hedgehog, C24II.,HHG1

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q62226

Gene Id:
Cys25-Gly198 (Cys25Ile-Ile)SIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Weight:
20kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 150mM NaCl, pH8.0.

Quality Statement:
Sonic Hedgehog (SHH) is a secreted factor which expressed in embryonic tissues that are critical for the patterning of the developing central nervous system, somite, and limb. SHH binds to the patched receptor, which functions in association with smoothened, to activate the transcription of target genes. In the absence of SHH, patched receptor represses the constitutive signaling activity of smoothened. SHH also regulates another factor, the gli oncogene. It regulates neural and hematopoietic stem cell fate and is important for thymocyte differentiation and proliferation as well as T cell determination. SHH-N is highly conserved, sharing >98% aa identity between mouse, human, rat, canine, porcine, and chicken Shh-N. Shh-N can be palmitoylated at itsThe Shh-N protein is highly conserved, sharing >98% aa identity between mouse, human, rat, canine, porcine, and chicken Shh-N. Shh-N can be palmitoylated at its N-terminal cysteine and modified by cholesterol addition at its C-terminus. These modifications contribute to the membrane tethering of the Shh protein as well as its assembly into various sized multimers.

Reference:
1. Marigo V, et al. (1995) Cloning, expression, and chromosomal location of SHH and IHH: two human homologues of the Drosophila segment polarity gene hedgehog. Genomics. 1;28(1):44-51. doi: 10.1006/geno.1995.1104.2​. 2.Gomes DC, et al. (2014) Sonic hedgehog signaling is active in human adrenal cortex development and deregulated in adrenocortical tumors. J Clin Endocrinol Metab. 99(7):E1209-16. doi: 10.1210/jc.2013-4098​.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-21R Protein
IGF-I/IGF-1 Protein
Popular categories:
Carboxypeptidase
A Disintegrin and Metalloprotease 22

Share this post on:

Author: Adenosylmethionine- apoptosisinducer