Share this post on:

Name:
Siglec-3/CD33 Protein

Synonyms:

Species Name:
Human

Label Name:
Human Fc Tag

Marker Name:
Unconjugated

Accession:
P20138

Gene Id:
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight:
70-75 kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Sialic acid-binding immunoglobulin-like lectins (Siglecs)1 are transmembrane sialic acid-binding proteins of the immunoglobulin (Ig) superfamily characterized by the presence of an N-terminal V-set Ig-like domain and variable numbers of C2 set domains (1). The first Siglecs to be characterized were Siglec-1, Siglec-2, Siglec-3 and myelin-associated Siglec-4 which share ∼25–30% sequence identity within the extracellular regions. Recent studies have uncovered the existence of a cluster of genes on human chromosome 19q13.3-4 that encode novel Siglecs highly related to CD33. This CD33-related subgroup includes Siglecs-3, -5, -6, -7, and -8, each of which share ∼50–70% sequence identity. These differences in expression and ligand binding suggest that each Siglec mediates a specific, nonredundant function in hemopoietic cell biology. CD33 (siglec-3) is the smallest siglec member. It preferentially binds to α2-6- and α2-3-sialylated glycans and strongly binds to sialylated ligands on leukemic cell line. Recently, the C1q complement system component has been established as a soluble ligand for CD33. CD33 is mainly expressed in the surface of human leukocytes of the myeloid lineage; however, it is important to note that it can also be expressed on lymphoid cells, including NK cells at several differentiation stages. Human CD33 is expressed on the cell membrane as two isoforms, CD33M, the full-length protein, and CD33m, lacking the V extracellular domain. The CD33 expression level has been recently related to Alzheimer’s disease pathology, autoimmune diseases such as systemic lupus erythematosus (SLE), type II diabetes, or infection.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Apolipoprotein E/APOE3 Protein
TECK/CCL25 Protein
Popular categories:
CD281/TLR1
Carbonic Anhydrase 1 (CA1)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer