Share this post on:

Name:
IGF-I Protein

Synonyms:
Insulin-Like Growth Factor I,IGFI,IGF1, IGF-1

Species Name:
Rat

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P08025

Gene Id:
Gly49-Ala118 GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Weight:
8kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM NaAC, pH5.0

Quality Statement:
Insulin-like growth factor I (IGF-I) belongs to the family of Insulin-like growth factors that are structurally homologous to proInsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. IGF-I is produced primarily by the liver as an endocrine hormone as well as in target tissues in a paracrine/autocrine fashion. The production of IGF-I is stimulated by growth hormone (GH) and can be retarded by undernutrition, growth hormone insensitivity, lack of growth hormone receptors, or failures of the downstream signaling pathway post GH receptor including SHP2 and STAT5B. IGF-I binds IGF-1R, IGF-2R, and the Insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression.Accession#: P08025 https://www.uniprot.org/uniprotkb/ P08025 /entry

Reference:
1. Bartlett WP, Li XS, Williams M. 1992. Brain Res Mol Brain Res, 12: 285-91.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SOD2/Mn-SOD Protein
IL-1R9/IL1RAPL2 Protein
Popular categories:
NOD-like Receptor
Cyclin Dependent Kinase Inhibitor 1A (CDKN2A)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer