Name:
IL-8 Protein
Synonyms:
Interleukin-8, IL8, CXCL8, NAP-1, NAF;
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P10145
Gene Id:
Ser28-Ser99SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Molecular Weight:
9kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
IL-8(Interleukin-8) is one of the first discovered chemokines and belongs to the CXCL family, in which the first two conserved cysteines are separated by one residue. In vivo, IL-8 exists in two forms: a 77-amino acid protein produced by endothelial cells, and the more active 72- amino acid protein produced by monocytes. IL-8 is often associated with inflammation, it has been cited as a proinflammatory mediator in gingivitis and psoriasis. The functions of IL-8 are to induce rapid changes in cell morphology, activate integrins, and release the granule contents of neutrophils. Thus, IL-8 can enhance the antimicrobial actions of defense cells. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis.
Reference:
1. Van Damme J, Rampart M, Conings R, et al. 1990. Eur J Immunol. 20:2113-8.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD19 Protein
CD84/SLAMF5 Protein
Popular categories:
Ubiquitin-Specific Protease 10
MIP-3 alpha/CCL20
