Share this post on:

Name:
Brain Natriuretic Peptide Protein

Synonyms:
Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32

Species Name:
Human

Label Name:
null

Marker Name:
Unconjugated

Accession:
P16860

Gene Id:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Weight:
3.5 kDa (Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris-HCl, 200mM NaCl, pH8.5

Quality Statement:
Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Thymidylate Protein
Myoglobin Protein
Popular categories:
CD158z/KIR3DL3
Ubiquitin-Specific Peptidase 25

Share this post on:

Author: Adenosylmethionine- apoptosisinducer