Share this post on:

Name:
NRG1/Heregulin-β1 Protein

Synonyms:
Pro-neuregulin-1;Neuregulin-1 beta 1;NRG1-beta 1;HRG1-beta 1; EGF;NRG1; GGF; HGL; HRGA; NDF; SMDF

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q02297-6

Gene Id:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIE FMEAE

Molecular Weight:
7-9 kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Heregulin-β 1 also known as neuregulin-1 (NRG-1) is a member of the epidermal growth factor (EGF) family of growth factors and acts as a ligand for ErbB family receptor tyrosine kinases. And NRG1 isoforms can signal in a paracrine, autocrine, or juxtacrine manner, playing a fundamental role during the development of the peripheral nervous system and during the process of nerve repair, suggesting that the treatment with NRG1 could improve functional outcome following injury. The NRG1 receptors are membrane-spanning receptor tyrosin kinases of the ErbB family (ErbB1–4), of which the EGF receptor (ErbB1) is the most prominent representative.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD44 Protein
Dermatopontin/DPT Protein
Popular categories:
CD41/Integrin alpha-IIb
BST-2/CD317

Share this post on:

Author: Adenosylmethionine- apoptosisinducer