Share this post on:

Name:
IL-8 Protein

Synonyms:
Interleukin-8, IL8, CXCL8, NAP-1, NAF;

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P10145

Gene Id:
Ala23-Ser99 AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Molecular Weight:
8.9kDa (Reducing)

Purity:
>95%SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mMTris,250mM NaCl,pH8.0.

Quality Statement:
IL-8(Interleukin-8)is one of the first discovered chemokines and belongs to the CXCL family, inwhich the first two conserved cysteines are separated by one residue. In vivo,IL-8 exists in two forms: a 77-amino acid protein produced by endothelial cells,and the more active 72- amino acid protein produced by monocytes. IL-8 is oftenassociated with inflammation, it has been cited as a proinflammatory mediatorin gingivitis and psoriasis. The functions of IL-8 are to induce rapid changesin cell morphology, activate integrins, and release the granule contents ofneutrophils. Thus, IL-8 can enhance the antimicrobial actions of defense cells.It is secreted by monocytes, macrophages and endothelial cells. IL-8 signalsthrough CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells.IL-8 is also a potent promoter of angiogenesis.

Reference:
1. Van Damme J, Rampart M, Conings R,et al. 1990. Eur J Immunol. 20:2113-8.1/2.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GMFG Protein
MME Protein
Popular categories:
Inter-Alpha-Trypsin Inhibitors (ITI)
Collectin Liver 1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer