Share this post on:

Name:
IL-4 Protein

Synonyms:
IL-4蛋白;Interleukin-4,B-cell IgG differentiation factor,B-cell growth factor 1,B-cell stimulatory factor 1,IGG1 induction factor,Lymphocyte stimulatory factor 1,IL-4,BSF-1

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P07750

Gene Id:
His23-Ser140MHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Weight:
14kDa (Non-reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/mg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to-70 °C as supplied. ·1 month, 2 to 8 °C under sterileconditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Mouse Interleukin-4(IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four α-helix structure. IL-4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL-4 is primarily expressed by Th2-biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by na?ve CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

Reference:
1、A Novel Rabies Vaccine Expressing CXCL13 Enhances Humoral Immunity by Recruiting both T Follicular Helper and Germinal Center B cells. Wang Z. et al. J Virol. 2017.2、AID Recognizes Structured DNA for Class Switch Recombination. Qi Qiao. et al. Molecular Cell. 2017.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Noggin Protein
RBKS Protein
Popular categories:
CD360/IL-21R
CD185/CXCR5

Share this post on:

Author: Adenosylmethionine- apoptosisinducer