Share this post on:

Name:
NT-4 Protein

Synonyms:
neurotrophic factor 4, neurotrophic factor 5, neurotrophin 4

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q80VU4

Gene Id:
Gly80-Ala209GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA

Molecular Weight:
16kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 500mM NaCl, pH8.0

Quality Statement:
Neurotrophin 4 (NT-4) is a neurotrophic factor which supports the survival and outgrowth of sensory neurons from embryonic chicken dorsal root ganglia, but has no significant effect on embryonic day 8 sympathetic ganglia1. It has a strong survival/proliferative action on NIH 3T3 cells expressing trkB but little activity on 3T3 cells expressing trkA. NT-4 was originally identified in Xenopus and viper, and was subsequently identified in rat and humans. Neurotrophin 4 is the least studied member of the neurotrophin family. Genetic knockout of NT4 does not result in loss of any DRG sensory neurons, although this factor does influence survival of spinal motor neurons. NT4 is expressed in muscle, and its expression is regulated by activity of innervating motor neurons, which increase its production, thereby providing trophic support to those innervating neurons. This provides an excellent example of bidirectional communication between the target and the afferent neurons, in which the activity of the innervating neurons and the release of trophic factor from the target influence each other to fine-tune the synaptic connections.

Reference:
1.\tCheryl L Stucky 1, Jung-Bum Shin, Gary R Lewin. Neurotrophin-4: a survival factor for adult sensory neurons. Curr Biol. 2002 Aug 20;12(16):1401-4. doi: 10.1016/s0960-9822(02)01072-2.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD276/B7-H3 Protein
IL-20 Protein
Popular categories:
BTN2A2
Fc epsilon RI

Share this post on:

Author: Adenosylmethionine- apoptosisinducer