Share this post on:

Name:
IGF-I Protein

Synonyms:
IGF-I Protein, IGF1A Protein, IGFI Protein

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P05017

Gene Id:
Gly49-Ala118 GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Weight:
8-9kDa (Non-Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12months from date of receipt, -20 to -70 °C as supplied. · 6months, -20 to -70 °C under sterile conditions after reconstitution.· 1week, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
50mM NaAc, pH6.0.

Quality Statement:
Insulin-like growth factor I (IGF-I) belongs tothe family of Insulin-like growth factors that are structurally homologous toproInsulin. Mature IGFs are generated by proteolytic processing of inactiveprecursor protein containing N-terminal and C-terminal propeptide regions.IGF-1 is produced primarily by the liver as an endocrine hormone as well as intarget tissues in a paracrine/autocrine fashion. The production of IGF-1 isstimulated by growth hormone (GH) and can be retarded by undernutrition, growthhormone insensitivity, lack of growth hormone receptors, or failures of thedownstream signaling pathway post GH receptor including SHP2 and STAT5B. IGF1binds IGF-1R, IGF-2R, and the Insulin receptor and plays a key role in cellcycle progression, cell proliferation and tumor progression.

Reference:
1.Bartlett WP,Li XS, Williams M. 1992. Brain Res Mol Brain Res, 12: 285-91.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF Protein
B7-2/CD86 Protein
Popular categories:
CD40
Frizzled-9

Share this post on:

Author: Adenosylmethionine- apoptosisinducer