Share this post on:

Name:
FGF-9 Protein

Synonyms:
FGF9, GAF, HBFG-9, MGC119914, MGC119915, SYNS3

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P54130

Gene Id:
Met1-Ser208 MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Weight:
22-25kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 500mM NaCl, pH8.0

Quality Statement:
FGF9(fibroblastgrowth factor 9, FGF9) is one of the fibroblast growth factor (FGF) familymembers. It is widely distributed in various tissues of human body and involvedin bone development, angiogenesis, embryonic development, damage repair, cellapoptosis, nerve regeneration, tumor growth and other physiological andpathological processes, and can effectively promote mitosis and cell growth.Current evidence suggests that FGF9 may play a prominent role not only in bonedevelopment and growth of cartilage into bone formation and generation, butalso has a significant impact on aspects of ovarian cancer, nerve regeneration,gonadal differentiation, there remains much to be discovered and investigatedon the functions and mechanisms of FGF18.

Reference:
1.Schmahl J. et al. (2004) Fgf9 induces proliferation and nuclearlocalization of FGFR2 in Sertoli precursors during male sex determination.Development. 131(15): 3627-36.2,Garcès A. et al. (2000) FGF9: a motoneuron survival factor expressed bymedial thoracic and sacral motoneurons. J Neurosci Res. 60(1): 1-9.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cystatin F/CST7 Protein
IGFBP-6 Protein
Popular categories:
Insulin Receptor (INSR)
BTN3A1/CD277

Share this post on:

Author: Adenosylmethionine- apoptosisinducer