Name:
FGF-18 Protein
Synonyms:
FGF18, fibroblast growth factor 18, zFGF5
Species Name:
Rat
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
O88182
Gene Id:
Glu28-Arg199 MEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSR
Molecular Weight:
20kDa
Purity:
>95% by SDS-PAGE & RP-HPLC
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20 mM Tris, 600 mM NaCl, pH 8.5
Quality Statement:
Fibroblast Growth Factor 18 (FGF-18) plays an important role in skeletal development and bone homeostasis. Mature human FGF-18 shares 99% amino acid sequence identity with mouse and rat FGF-18. It is expressed in embryonic somites and the neural fold, adult lung, cerebellar and hippocampal neurons, hair follicle root sheath cells, and osteogenic mesenchymal cells. FGF-18 is a heparin-binding growth factor that belongs to the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-18 is required for normal skeletal development. Recombinant Human FGF-18 derived from E.coli is a 20 kDa protein consisting of 173 amino acid residues, resulting from C-terminal truncation of the full length protein.
Reference:
1、Davidson D. et al. (2005) Fibroblast growth factor (FGF) 18 signals through FGF receptor 3 to promote chondrogenesis. J Biol Chem. 280(21): 20509-15.2、Liu Z. et al. (2007) FGF18 is required for early chondrocyte proliferation, hypertrophy and vascular invasion of the growth plate. Dev Biol. 302(1): 80-91.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OSTM1 Protein
VEGF-DD Protein
Popular categories:
CD82
IL-4R alpha/CD124
