Share this post on:

Name:
IgG2b Fc Protein

Synonyms:

Species Name:
Mouse

Label Name:
null

Marker Name:
Unconjugated

Accession:
P01867-2

Gene Id:
EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGL

Molecular Weight:
32-35 kDa(reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Immunoglobulin G (IgG) is the main antibody component in normal human serum, which is produced and secreted by B cells. It is a molecule with a molecular weight of about 150kDa. IgG contains two heavy chains (50kDa) and two light chains (25kDa), which are connected by disulfide bonds. After cleavage by pepsin, IgG is divided into F (ab) s with an antigen binding site and a highly conserved Fc fragment. The Fc fragment has a highly conserved n-glycosylation site. There are 5 subtypes of IgG in mice (IgG1, IgG2a, IgG2b, IgG2c and IgG3) and 4 subtypes in rats (IgG1, IgG2a, IgG2b and IgG2c). Some studies have found that IgG2a is superior to IgG1 in activating complements. IgG2 is mainly used to neutralize antigen or block the binding of receptor ligand. In addition, human EGFR antibody IgG2 can mediate ADCC effect through myeloid cells.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Platelet factor 4 Protein
ATG5 Protein
Popular categories:
Siglec-16
FGF-19

Share this post on:

Author: Adenosylmethionine- apoptosisinducer