Share this post on:

Name:
Fc γ RIII/CD16 Protein

Synonyms:
Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q8SPW2-1

Gene Id:
GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQGGGSGGGSHHHHHHHH

Molecular Weight:
37-46 kDa(reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs is identified as three types: RI (CD64), RII (CD32) and RIII (CD16). CD16 is a low-affinity Fc receptor, which has been identified as Fc receptor Fc γ RIII (a (CD16a) and Fc γ RIIIb (CD16b). These receptors bind to the Fc portion of the IgG antibody and are encoded by two different highly homologous genes in a cell type-specific manner. Mature crab-eating monkey Fc γ RIII consists of an extracellular domain of 192 amino acids, a transmembrane segment of 21 amino acids and a cytoplasmic domain of 25 amino acids. The extracellular domain has 92% and 90% amino acid homology with human Fc γ RIIIA and Fc γ RIIIB, respectively. Fc γ RIII is expressed on NK cells, T cells, monocytes and macrophages, and exists on the surface of natural killer cells, neutrophils, polymorphonuclear leukocytes, monocytes and macrophages. It is involved in phagocytosis, secretion of enzymes and inflammatory mediators, antibody-dependent cytotoxicity and clearance of immune complexes.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TIE-2 Protein
HMBS/Porphobilinogen deaminase Protein
Popular categories:
ALK/LTK Subfamily
HIV Integrase

Share this post on:

Author: Adenosylmethionine- apoptosisinducer