Name:
Fc γ RIIA/CD32a Protein
Synonyms:
Low affinity immunoglobulin gamma Fc region receptor II-a, IgG Fc receptor II-a, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, CD32, FCGR2A, FCG2, FCGR2A1, IGFR2
Species Name:
Rat
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Gene Id:
QTGDLLKAVVKRDPPWIQVLKDDTVTLTCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPVHLEVISDWLLLQTPQLVFLEGERITLRCHGWKSIQLARISFLQNGEFVSFHPYNVSYSISNANHSHSGDYYCKAYLGRTEHVSKPVTITVQGSATASTSSLGGGSGGGSHHHHHHHH
Molecular Weight:
34-53 kDa(reducing)
Purity:
＞95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.2EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs is identified as three types: RI (CD64), RII (CD32) and RIII (CD16) can produce multiple subtypes. CD32 is a low affinity receptor of IgG. There are 3 Fc γ RII / CD32 genes (A, B and C) in human, 2 genes in monkeys (An and B) and one Fc γ RII B in mice. Mature Fc γ RIIA is a type 1 transmembrane glycoprotein. About 40 kDa is composed of extracellular domain, transmembrane domain and cytoplasmic domain, and the extracellular domain includes two IgG domains. The extracellular domain Fc γ RIIA of rat shares 52% of the amino acid sequence with that of human Fc γ RIIA. CD32a is expressed in a variety of immune cells, such as macrophages, neutrophils, platelets and so on. Inhibition of ITIM receptors may also be co-expressed and co-participated by specific ligands to initiate inflammatory responses during ligand binding, including cytolysis, phagocytosis, degranulation and production of cytokines. This response can be regulated by co-expression of inhibitory receptors such as CD32B, and the intensity of the signal depends on the proportion of activated and inhibitory receptors.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
APEG1 Protein
PDGF-CC Protein
Popular categories:
Integrin alpha V beta 6
LRP-1/CD91
