Share this post on:

Name:
FGF-12 Protein

Synonyms:
Fibroblast growth factor homologous (FHF-1), Myocyte-activating factor, \tFGF12B

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P61328-2

Gene Id:
Met1-Thr181 MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRV

Molecular Weight:
21kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB, 150mM NaCl, 1mM DTT, 1mM EDTA, pH 7.4

Quality Statement:
Fibroblast growth factor 12 (FGF-12), also known as fibroblast growth factor homologous factors (FHF), is cytosolic proteins that is homologous to fibroblast growth factors but is not secreted. FGF12 modulates both cardiac Na+ and Ca+ channel by binding to the conserved proximal part of the C-terminal domain of voltage-gated sodium channels Nav1.5. However, a single missense mutation in FGF12-B (Q7R-FGF12) reduced binding to the NaV1.5 C-terminus, yielding a Brugada Syndrome phenotype.

Reference:
1.\tAm J Physiol Heart Circ Physiol. 2015 Jun 15;308(12):H1463-73.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HLA-E*0103 Complex Tetramer Protein
CSRP1 Protein
Popular categories:
IL-13 Receptor
IL-31 Receptor

Share this post on:

Author: Adenosylmethionine- apoptosisinducer