Share this post on:

Name:
IL-21 Protein

Synonyms:
IL-21, rMuIL-21, Za11

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q9ES17

Gene Id:
Pro25-Ser146 MPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Weight:
14kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 100mM NaCl, pH8.0

Quality Statement:
IL-21 belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. IL-21 is a T-cell–derived cytokine that works in concert with other γc cytokines. It synergizes with IL-7 and IL-15 to expand and activate CD8 T cells. IL-21 also augments the activity of NK cells. IL-21, along with IL-6, drives differentiation of Tfh. Tfh cells are found preferentially in B-cell follicles, where, under the control of the transcription factor BCL6, they regulate B-cell development, activation, and class switching. Tfh cells are also a source of IL-21. IL-21 appears to have some anticancer properties, and it has been tested in the treatment of melanoma.

Reference:
1、Coquet J M. et al. (2007) IL-21 is produced by NKT cells and modulates NKT cell activation and cytokine production. J Immunol. 178(5):2827-34.2、Wei L. et al. (2007) IL-21 is produced by Th17 cells and drives IL-17 production in a STAT3-dependent manner. J Biol Chem. 282(48):34605-10.3、Parrish-Novak J. et al. (2002) Interleukin-21 and the IL-21 receptor: novel effectors of NK and T cell responses. J Leukoc Biol. 72(5):856-63. 4、Kuchen S. et al. (2007) Essential role of IL-21 in B cell activation, expansion, and plasma cell generation during CD4+ T cell-B cell collaboration. J Immunol. 179(9): 5886-96.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD5L Protein
ACE2 Protein
Popular categories:
CD185
SDF-1/CXCL12

Share this post on:

Author: Adenosylmethionine- apoptosisinducer