Name:
IL-21 Protein
Synonyms:
IL-21, rMuIL-21, Za11
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
Q9ES17
Gene Id:
Pro25-Ser146 MPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Molecular Weight:
14kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 100mM NaCl, pH8.0
Quality Statement:
IL-21 belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. IL-21 is a T-cell–derived cytokine that works in concert with other γc cytokines. It synergizes with IL-7 and IL-15 to expand and activate CD8 T cells. IL-21 also augments the activity of NK cells. IL-21, along with IL-6, drives differentiation of Tfh. Tfh cells are found preferentially in B-cell follicles, where, under the control of the transcription factor BCL6, they regulate B-cell development, activation, and class switching. Tfh cells are also a source of IL-21. IL-21 appears to have some anticancer properties, and it has been tested in the treatment of melanoma.
Reference:
1、Coquet J M. et al. (2007) IL-21 is produced by NKT cells and modulates NKT cell activation and cytokine production. J Immunol. 178(5):2827-34.2、Wei L. et al. (2007) IL-21 is produced by Th17 cells and drives IL-17 production in a STAT3-dependent manner. J Biol Chem. 282(48):34605-10.3、Parrish-Novak J. et al. (2002) Interleukin-21 and the IL-21 receptor: novel effectors of NK and T cell responses. J Leukoc Biol. 72(5):856-63. 4、Kuchen S. et al. (2007) Essential role of IL-21 in B cell activation, expansion, and plasma cell generation during CD4+ T cell-B cell collaboration. J Immunol. 179(9): 5886-96.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD5L Protein
ACE2 Protein
Popular categories:
CD185
SDF-1/CXCL12