NT-4 Protein | Adenosylmethionine

Name:
NT-4 Protein

Synonyms:
neurotrophic factor 4, neurotrophic factor 5, neurotrophin 4, neurotrophin 5, neurotrophin-5, NT4, NT-4, NT-5, NTF4, NTF5, GLC10

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P34130

Gene Id:
Gly81-Ala210 MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Molecular Weight:
15kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 500mM NaCl, pH8.0

Quality Statement:
Neurotrophin 4 (NT-4) is a neurotrophic factor which supports the survival and outgrowth of sensory neurons from embryonic chicken dorsal root ganglia, but has no significant effect on embryonic day 8 sympathetic ganglia1. It has a strong survival/proliferative action on NIH 3T3 cells expressing trkB but little activity on 3T3 cells expressing trkA. NT-4 was originally identified in Xenopus and viper, and was subsequently identified in rat and humans. Neurotrophin 4 is the least studied member of the neurotrophin family. Genetic knockout of NT4 does not result in loss of any DRG sensory neurons, although this factor does influence survival of spinal motor neurons. NT4 is expressed in muscle, and its expression is regulated by activity of innervating motor neurons, which increase its production, thereby providing trophic support to those innervating neurons. This provides an excellent example of bidirectional communication between the target and the afferent neurons, in which the activity of the innervating neurons and the release of trophic factor from the target influence each other to fine-tune the synaptic connections.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
S100B Protein
Animal-Free IL-30/IL-27A Protein
Popular categories:
PDGF-AB
Dengue virus Capsid Proteins

Author: Adenosylmethionine- apoptosisinducer

Related Posts