Name:
IP-10/CXCL10 Protein
Synonyms:
C7, crg-2, gIP-10, IFI10, INP10, IP-10, mob-1, SCYB10, CXCL10
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P02778
Gene Id:
Val22-Pro98 VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Molecular Weight:
10-11kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 500mM NaCl, 1mM TCEP, pH8.0
Quality Statement:
IP-10 (Interferon gamma-induced protein 10 or CXCL10) is a proinflammatory cytokine that is secreted by various cell types in response to stimuli such as IFN-γ and LPS. It binds to CXCR3 receptor and regulates chemotaxis, apoptosis, growth, and angiostasis of immune cells. IP-10 is involved in the pathogenesis of many inflammatory disorders, such as autoimmune diseases, HIV infection, and tumour growth. CXCL10 is the chemokine released in highest quantities by islets immediately following islet perfusion in the transplant procedure, as identified by serum samples from 34 patients undergoing islet transplantion. Inflammatory mediators such as physical and chemical stress by isolation and infusion procedures stimulate the release of CXCL10 through an NFAT-MAPK signaling pathway. In particular, interferon-γ release at high concentrations during islet infusion contributes to the stimulation of CXCL10 and the loss of up to 50% of the islet graft immediately following transplant.
Reference:
1、Swaminathan G J. et al. (2003) Crystal structures of oligomeric forms of the IP-10/CXCL10 chemokine. Structure. 11(5): 521-532.2、Booth V. et al. (2002) The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions. Biochemistry. 41(33): 10418-10425.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-27R alpha/TCCR Protein
Apolipoprotein E/APOE4 Protein
Popular categories:
Neurokinin B
CD324/E-Cadherin
