Share this post on:

Name:
FGF-8c Protein

Synonyms:
FGF-8c, rMuFGF-8c, AIGF, HBGF-8

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P37237

Gene Id:
Gln23-Arg268 MQVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Weight:
28-29kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 100mM NaCl, pH8.0

Quality Statement:
Fibroblast Growth Factor 8 was originally identified as an androgen-dependent growth of mouse mammary carcinoma cells. The primary transcript of mouse FGF-8 is alternatively spliced to generate at least 8 secreted isoforms that differ at their amino terminus. The differences between the isoforms exist in the number of potential N-linked glycosylation sites. In mouse, the eight isoforms are labeled as 8a through 8h. Human FGF-8 is limited to only four isoforms. Only isoforms 8a, 8b, 8e, and 8f are synthesized in humans. Mouse and human 8a and 8b isoforms are 100% identical, while the 8e and 8f isoforms are 98% identical. The FGF-8 isoforms differentially activate the various alternatively spliced forms of the FGF receptors 1-3, and FGF receptor 4. The isoform FGF-8c activates FGF R3c and FGF R4.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EphB2 Protein
CD40L/CD154/TRAP Protein
Popular categories:
ADAM28
c-Jun N-terminal kinase 2 (JNK2)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer