Share this post on:

Name:
IFN-α 1b Protein

Synonyms:
Interferon-α1b, IFN-α 1b, Interferon alpha-1/13

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P01562

Gene Id:
Cys24-Glu189CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIM RSLSLSTNLQ ERLRRKE

Molecular Weight:
18-19kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 150mM NaCl, 1mM TCEP, pH8.0

Quality Statement:
IFN-α is a cytokine that has an immunomodulatory function. It plays an important role not only in antiviral activity but also in several physiologic functions, such as activation of dendritic cells and accelerated expression of major histocompatibility complex I and II molecules that may cause increased antigen presentation. Many IFN-alpha subtypes differ in their sequences at only one or two positions. Among the 13 subtypes of human IFNalpha, IFNalpha-1 subtype has 2 variants, named IFN-α 1a and IFN-α 1b, that differ from each other in only 1 amino acid, at residue 114. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. IFN-α is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Reference:
1、Liu Y. et al. (2021) Type I interferon is induced by hemolysis and drives antibody-mediated erythrophagocytosis in sickle cell disease. Blood. 2021, 138(13): 1162-1171.2、Xin X. et al. (2019) Mechanisms of IFNalpha-1a-Induced Apoptosis in a Laryngeal Cancer Cell Line. Med Sci Monit. 25: 7100-7114.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MMP-10 Protein
HGPRT Protein
Popular categories:
CD40
Carboxypeptidase B1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer