Share this post on:

Name:
HRP-Labeled ATG4B Protein

Synonyms:
ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353

Species Name:
Human

Label Name:
His Tag

Marker Name:
HRP

Accession:
Q9Y4P1

Gene Id:
Met1-Leu393, with N-terminal 8*His HHHHHHHHMDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL

Molecular Weight:
45kDa

Purity:
>95% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Initiation and development of autophagy is modulated by several autophagy-related (ATG) genes, which have been identified in yeast and human. Autophagy begins with the formation and maturation of the double-membraned autophagosomes which engulf and deliver cargoes to lysosomes for degradation. The assembling process of autophagosomes is mediated by a family of core ATG proteins, including two ubiquitin-like systems. First, inactive precursor MAP1LC3/LC3 is cleaved by protease ATG4B at the conserved C-terminal glycine residue. After a set of transfer and activation by ATG7, ATG3 and ATG12-ATG5-ATG16L1, the processed LC3 (LC3-I) finally conjugates with phosphatidylethanolamine (PE) at the exposed glycine site via a covalent bond. So far, lipidated LC3, called LC3-II, has become a biomarker of autophagy because of its characteristic of anchoring into the autophagosome membrane. Upon fusion with lysosomes, ATG4B can, in turn, deconjugate LC3-PE to release LC3-I to the cytoplasm for reuse. Hence, ATG4B serves as a priming and delipidation enzyme whose fine regulation is essential for autophagy process.

Reference:
1、Zheng X. et al. (2020) The protease activity of human ATG4B is regulated by reversible oxidative modification. Autophagy. 16(10): 1838-1850.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PD-L2 Protein
Fractalkine/CX3CL1 Protein
Popular categories:
Siglec-3/CD33
EphB1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer