Name:
Epigen Protein
Synonyms:
Epigen, EPGN, EPG, Epigen precursor
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
Q6UW88
Gene Id:
Ala24-Ala95AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Molecular Weight:
8kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 150mM NaCl, pH8.0
Quality Statement:
Epigen, human (EPGN) is a member of the epidermal growth factor family. EPGN is ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. EPGN Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases. The precursor of EPG is a widely expressed transmembrane glycoprotein that undergoes cleavage at two sites to release a soluble EGF-like domain. EPGN might represent the last EGF-like growth factor and define a category of low affinity ligands, whose bioactivity differs from the more extensively studied high affinity ligands. Recombinant EPGN is expressed by Escherichia coli, composed of 72 (Ala24-Ala95) amino acids.
Reference:
1、Freed D M. et al. (2017) EGFR Ligands Differentially Stabilize Receptor Dimers to Specify Signaling Kinetics. Cell. 171(3):683-695.2、Kochupurakkal B S. et al. (2005) Epigen, the last ligand of ErbB receptors, reveals intricate relationships between affinity and mitogenicity. J Biol Chem. 280(9): 8503-8512.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PDGF R beta Protein
CD117/c-Kit Protein
Popular categories:
Ebola Virus GP2
TIE-2/CD202b
