Share this post on:

Name:
IL-3 Protein

Synonyms:
IL-3, MCGF, MULTI-CSF

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P01586

Gene Id:
Asp33-Cys166 MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Weight:
16kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. Interleukin-3 is a cytokine that regulates the proliferation, differentiation, activation, and survival of myeloid progenitor cells and the mast cells, eosinophils, basophils, neutrophils, monocytes, megakaryocytes, and erythroid cells that they give rise to (1–3). Although IL-3 was first defined as a CSF (multi-CSF), it is not essential to hemopoiesis, and it may function in vivo pre dominantly as a proinflammatory cytokine activating mature myeloid cells. The IL-3 gene exists within a one megabase conserved cytokine gene cluster that also contains the genes for IL-4, IL-5, IL-13, and GM-CSF. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.

Reference:
1、Gröger M. et al. (2004) IL-3 induces expression of lymphatic markers Prox-1 and podoplanin in human endothelial cells. J Immunol. 173(12): 7161-7169.2、Hawwari A. et al. (2002) The human IL-3 locus is regulated cooperatively by two NFAT-dependent enhancers that have distinct tissue-specific activities. J Immunol. 169(4): 1876-1886.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Tetranectin/CLEC3B Protein
DR3/TNFRSF25 Protein
Popular categories:
Glycoprotein Hormone alpha-2 (GPHA2)
Ubiquitin-Specific Peptidase 28

Share this post on:

Author: Adenosylmethionine- apoptosisinducer