Name:
IgG3 Fc Protein
Synonyms:
Ig gamma-3 chain C region,IgG3 Fc
Species Name:
Human
Label Name:
null
Marker Name:
Unconjugated
Accession:
P01860
Gene Id:
ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
Molecular Weight:
35-43 kDa(Reducing)
Purity:
＞95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
Immunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in secondary antibody reaction, plasma B cell synthesis and secretion, constitute 75% of human serum immunoglobulin. There are four subtypes of IgG antibody: IgG1, IgG2, IgG3 and IgG4, which decrease in turn in serum. The spatial structure of these four subtypes is similar and the heavy chain sequences of each subtype are highly homologous. IgG3 has an extended hinge region, and its core hinge region has 11 disulfide bonds, so it is unstable for protease cleavage. After pepsin cleavage, IgG3 is divided into two antigen binding sites F (ab) s and a highly conserved Fc segment, and the Fc segment has a highly conserved N-glycosylation site. Fc fragments have been shown to mediate phagocytosis, trIgGer inflammation, and target IgG to specific tissues. The binding ability of IgG3 to Fc γ Rs was the strongest, and the effects of ADCC, ADCP and CDC were stronger than that of IgG1.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Serpin A8/Angiotensinogen Protein
PDGF-DD Protein
Popular categories:
RSV Proteins
Cathepsin E
