Prolactin R/PRLR Protein | Adenosylmethionine

Name:
Prolactin R/PRLR Protein

Synonyms:
Prolactin R, PRLR, PRL-R

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P16471

Gene Id:
Gln25-Asp234, with C-terminal 8*His QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDGGGSHHHHHHHH

Molecular Weight:
32-36kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Prolactin receptor (PRLR) is a single-pass transmembrane receptor belonging to the type I cytokine receptor superfamily, and contains two fibronectin type-III domains. Knockout Prolactin receptor gene (PRL-R) mice are animal models for Prolactinomas and PRL acts via autocrine/paracrine inhibiting lactotroph proliferation. Recently, variants of the PRL-R were identified in Prolactinoma patients and their frequency was higher compared to individuals from the genomic database. As a transmembrane receptor, the Prolactin receptor (PRL-R) interacts with Prolactin. The PRL-R also binds and is activated by growth hormone (GH) and human placental lactogen (hPL). Moreover, The PRLR has been found to be essential for lobuloalveolar maturation of the mammary glands during pregnancy, as evidenced by the fact that PRLR knockout mice show severely impaired development of lobuloalveolar structures.

Reference:
1、Bole-Feysot C. et al. (1998) Prolactin (PRL) and its receptor: actions, signal transduction pathways and phenotypes observed in PRL receptor knockout mice. Endocr Rev. 19(3): 225-268.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Annexin A5/ANXA5 Protein
GMP IL-1 alpha Protein
Popular categories:
Complement Factor H Related 3
Muscle-Specific Kinase (MuSK)

Author: Adenosylmethionine- apoptosisinducer

Related Posts