Share this post on:

Name:
IgG2b Fc Protein

Synonyms:
Ig gamma-2 chain C region,IgG2B Fc

Species Name:
llama

Label Name:
null

Marker Name:
Unconjugated

Accession:
AAX73259.1

Gene Id:
EPKTPKPQPQPQPQPNPTTESKCPKCPAPELLGGPSVFIFPPKPKDVLSISGRPEVTCVVVDVGQEDPEVSFNWYIDGAEVRTANTRPKEEQFNSTYRVVSVLPIQHQDWLTGKEFKCKVNNKALPAPIEKTISKAKGQTREPQVYALAPHREELAKDTVSVTCLVKGFYPPDINVEWQRNRQPEPEGTYATTPPQLDNDGTYFLYSKLSVGKNTWQRGETFTCVVMHETLHNHYTQKSISQS

Molecular Weight:
35-40kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Immunoglobulin G (IgG) is a kind of monomer immunoglobulin which is developed and secreted by effective B cells and participates in secondary antibody reaction. IgG has four subclasses (IgG1,IgG2,IgG3,IgG4). IgG2 contains two members: IgG2a and IgG2b, both of which belong to the Fc fragments of IgG antibodies. Fc fragments have been shown to mediate phagocytosis, trIgGer inflammation, and target immunoglobulin Ig to specific tissues. In addition, some studies have shown that protein G or protein An on the surface of some staphylococci and Streptococcus strains can also specifically bind to the Fc region.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-24 Protein
B7-H4 Protein
Popular categories:
Delta-like 4 (DLL4)
ADAMTS1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer