Share this post on:

Name:
DENR Protein

Synonyms:
Protein DRP1, Smooth muscle cell-associated protein 3 (SMAP-3)

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
O43583

Gene Id:
Met1-Lys198, with N-terminal 8*His HHHHHHHHMAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

Molecular Weight:
27kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
The density regulated protein (DENR) was discovered as a protein, whose synthesis is increased at high cell density. It is also overexpressed in breast and ovarian cancers. In translation, DENR functions as a stable heterodimer with malignant T-cell-amplified sequence 1, which interacts with the 40S ribosomal subunit during initiation, reinitiation and recycling stages. Diseases associated with DENR include Hypertrichosis Universalis Congenita, Ambras Type and Optic Nerve Disease.

Reference:
1.\tDeyo J.E., Chiao P.J., Tainsky M.A. drp, a novel protein expressed at high cell density but not during growth arrest. DNA Cell Biol. 1998;17(5):437-447. 2.\tOh J.J. Identification of differentially expressed genes associated with HER-2/neu overexpression in human breast cancer cells. Nucleic Acids Res. 1999;27(20):4008-4017. 3.\tLomakin I.B. Crystal structure of the human ribosome in complex with DENR-MCT-1. Cell Rep. 2017;20(3):521-528. 4.\tSkabkin M.A. Activities of Ligatin and MCT-1/DENR in eukaryotic translation initiation and ribosomal recycling. Genes Dev. 2010;24(16):1787-1801. 5.\tWeisser, M., et al., Structural and functional insights into human re-initiation complexes. Mol Cell, 2017;67(3): p. 447-456.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Glypican-3/GPC3 Protein
CTRC Protein
Popular categories:
BCA-1/CXCL13
Carboxypeptidase E

Share this post on:

Author: Adenosylmethionine- apoptosisinducer