Share this post on:

Name:
LR3-IGF-I Protein

Synonyms:
LR3 Insulin-like Growth Factor-I, MGF, IGFI, IGF1A, IGF, IBP1

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P05019

Gene Id:
Gly49-Ala118 (Glu51Arg)MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPA KSA

Molecular Weight:
9kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM NaAC, 20mM HAC, pH4.5

Quality Statement:
IGF-I is a well-characterized basic peptide secreted by the liver that circulates in the blood. It has growth-regulating, Insulin-like, mitogenic activities. IGF-I is a growth factor that has a major, but not absolute, dependence on somatotropin. It is believed to be mainly active in adults in contrast to IGF-II, which is also a major fetal growth factor. Human Long R3 Insulin-like Growth Factor-I (rhLR3-IGF-I) contains an 83 amino acid analog of human IGF-I. Compared to the complete human IGF-I sequence, an addition of the rhLR3-IGF-1 includes the substitution of an Arg for the Glu at position 3 (hence R3) and a13 amino acid extension peptide at the N-terminus. An enhanced potency is due to the markedly decreased binding of human Long R3-IGF-I to IGF binding proteins which normally inhibit the biological actions of IGFs.

Reference:
1、Richman C. et al. (1999) Recombinant human Insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 140(10): 4699-4705. 2、Carlson S W. et al. (2018) Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 35(13):1467-1480.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GYPA/CD235a Protein
HMGB1/HMG-1 Protein
Popular categories:
BTN2A2
GITR

Share this post on:

Author: Adenosylmethionine- apoptosisinducer